Loading...
Statistics
Advertisement

Welcome to SEGWAYS.BIZ
www.segways.biz/

Segways.biz

Advertisement
Segways.biz is hosted in United States / Scottsdale . Segways.biz doesn't use HTTPS protocol. Number of used technologies: 3. First technologies: CSS, Html, Javascript, Number of used javascripts: 2. First javascripts: Caf.js, Jquery-1.3.1.min.js, Number of used analytics tools: 0. Its server type is: Microsoft-IIS/7.5.

Technologies in use by Segways.biz

Technology

Number of occurences: 3
  • CSS
  • Html
  • Javascript

Advertisement

Javascripts

Number of occurences: 2
  • caf.js
  • jquery-1.3.1.min.js

Advertise

Number of occurences: 1
  • Google Adsense

Server Type

  • Microsoft-IIS/7.5

Powered by

  • ASP.NET

Conversion rate optimization

visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Segways.biz

Missing HTTPS protocol.

    Meta - Segways.biz

    Number of occurences: 1
    • Name: robots
      Content: index,nofollow

    Server / Hosting

    • IP: 184.168.221.96
    • Latitude: 33.61
    • Longitude: -111.89
    • Country: United States
    • City: Scottsdale

    Rname

    • ns01.cashparking.com
    • smtp.secureserver.net
    • mailstore1.secureserver.net

    Target

    • dns.jomax.net

    HTTP Header Response

    HTTP/1.1 200 OK Cache-Control: no-cache Pragma: no-cache Content-Length: 8141 Content-Type: text/html; charset=utf-8 Expires: -1 Server: Microsoft-IIS/7.5 X-AspNet-Version: 4.0.30319 X-Powered-By: ASP.NET Date: Mon, 13 Jun 2016 11:06:13 GMT Age: 1 X-Cache: MISS from s_mf15 X-Cache-Lookup: MISS from s_mf15:80 Via: 1.1 s_mf15 (squid/3.5.6) Connection: keep-alive

    DNS

    host: segways.biz
    1. class: IN
    2. ttl: 600
    3. type: A
    4. ip: 184.168.221.96
    host: segways.biz
    1. class: IN
    2. ttl: 3600
    3. type: NS
    4. target: ns01.cashparking.com
    host: segways.biz
    1. class: IN
    2. ttl: 3600
    3. type: SOA
    4. mname: ns01.cashparking.com
    5. rname: dns.jomax.net
    6. serial: 2012100100
    7. refresh: 28800
    8. retry: 7200
    9. expire: 604800
    10. minimum-ttl: 86400
    host: segways.biz
    1. class: IN
    2. ttl: 3600
    3. type: MX
    4. pri: 0
    5. target: smtp.secureserver.net
    host: segways.biz
    1. class: IN
    2. ttl: 3600
    3. type: MX
    4. pri: 10
    5. target: mailstore1.secureserver.net

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.egways.biz, www.seegways.biz, www.eegways.biz, www.swegways.biz, www.wegways.biz, www.sdegways.biz, www.degways.biz, www.sxegways.biz, www.xegways.biz, www.sfegways.biz, www.fegways.biz, www.sgegways.biz, www.gegways.biz, www.stegways.biz, www.tegways.biz, www.sgways.biz, www.sxgways.biz, www.sesgways.biz, www.ssgways.biz, www.sewgways.biz, www.swgways.biz, www.sergways.biz, www.srgways.biz, www.sefgways.biz, www.sfgways.biz, www.sevgways.biz, www.svgways.biz, www.secgways.biz, www.scgways.biz, www.seqgways.biz, www.sqgways.biz, www.seagways.biz, www.sagways.biz, www.seygways.biz, www.sygways.biz, www.seways.biz, www.segsways.biz, www.sesways.biz, www.segxways.biz, www.segyways.biz, www.seyways.biz, www.seghways.biz, www.sehways.biz, www.segnways.biz, www.senways.biz, www.segcways.biz, www.secways.biz, www.segdways.biz, www.sedways.biz, www.segeways.biz, www.seeways.biz, www.segrways.biz, www.serways.biz, www.segtways.biz, www.setways.biz, www.segbways.biz, www.sebways.biz, www.segvways.biz, www.sevways.biz, www.segw ays.biz, www.seg ays.biz, www.segwcays.biz, www.segcays.biz, www.segways.biz, www.segwdays.biz, www.segdays.biz, www.segwfays.biz, www.segfays.biz, www.segwbays.biz, www.segbays.biz, www.segwys.biz, www.segwaoys.biz, www.segwoys.biz, www.segwapys.biz, www.segwpys.biz, www.segwa9ys.biz, www.segw9ys.biz, www.segways.biz, www.segwys.biz, www.segwaiys.biz, www.segwiys.biz, www.segwauys.biz, www.segwuys.biz, www.segwas.biz, www.segwayzs.biz, www.segwazs.biz, www.segwayas.biz, www.segwaas.biz, www.segwayss.biz, www.segwass.biz, www.segwayds.biz, www.segwads.biz, www.segways.biz, www.segwas.biz, www.segwaycs.biz, www.segwacs.biz, www.segway s.biz, www.segwa s.biz, www.segway.biz, www.segwayse.biz, www.segwaye.biz, www.segwaysw.biz, www.segwayw.biz, www.segwaysd.biz, www.segwayd.biz, www.segwaysx.biz, www.segwayx.biz, www.segwaysf.biz, www.segwayf.biz, www.segwaysg.biz, www.segwayg.biz, www.segwayst.biz, www.segwayt.biz,

    Other websites we recently analyzed

    1. ## Hidráulica Vale do Aço Service ##
      Site da Hidráulica Vale do Aço service
      Curitiba (Brazil) - 177.12.174.104
      Server software: Apache
      Technology: CSS, Php
      Number of meta tags: 18
    2. Mirador Aldaya
      Mountain View (United States) - 216.58.208.33
      Server software: GSE
      Technology: CSS, Html, Html5, Iframe, Javascript, Php, Schema.org, SVG, Wordpress, Add This, Google +1 Button
      Number of Javascript: 3
      Number of meta tags: 3
    3. Mijn Talent
      Netherlands - 109.71.51.117
      Server software: Apache/2.4.18 (Unix) OpenSSL/1.0.1e-fips mod_bwlimited/1.4 mod_fcgid/2.3.9
      Technology: CSS, Google Font API, Html, Javascript
      Number of Javascript: 3
      Number of meta tags: 2
    4. smallkitchenappliancesreviews.com
      Scottsdale (United States) - 184.168.221.104
      Server software: Microsoft-IIS/7.5
      Technology: Html
    5. Welcome to www.rolandkessel.nl
      www.rolandkessel.nl
      Netherlands - 83.96.159.15
      Server software: Apache/2
      Technology: CSS, Html, Javascript, Php
      Number of Javascript: 6
      Number of meta tags: 5
    6. performancecarsales.co.uk
      United Kingdom - 81.21.76.62
      Server software: Apache/2.2.3 (CentOS)
      Technology: CSS, Html, Javascript, Php
      Number of Javascript: 1
      Number of meta tags: 1
    7. Bible Sayings of the Fathers - sayings of moses, sayings of abraham, sayings of Isaach, sayings of Jacob
      Scottsdale (United States) - 23.229.188.67
      Server software: Apache
      Technology: CSS, Html
      Number of meta tags: 1
    8. © 2016 BAVUKISE
      coming soon template based on HTML5
      South Africa - 41.185.8.62
      Server software: Apache
      Technology: CSS, Google Font API, Html, Php, Google Analytics
      Number of Javascript: 5
      Number of meta tags: 5
    9. weekend365 - Home
      weekend365 ordnance survey map-based gifts
      San Francisco (United States) - 199.34.228.100
      Server software: Microsoft-IIS/7.5
      Technology: CSS, Html, Html5, Javascript, Google Analytics, Quantcast Measurement, Webly
      Number of Javascript: 5
      Number of meta tags: 3
    10. gulfdrug.net
      Road Town (Virgin Islands, British) - 208.91.197.132
      Server software: Apache
      Technology: Html
      Number of meta tags: 2

    Check Other Websites